PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000133817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 207aa    MW: 23286.1 Da    PI: 7.5063
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000133817genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l+++++ +G ++Wkt+a+  g++R++k+c++rw++yl
    MDP0000133817 15 KGPWTGEEDRKLAEYIEIHGAKRWKTVASIAGLNRCGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding51.13.2e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000133817  68 RGNISDDEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4351062IPR017930Myb domain
SuperFamilySSF466891.45E-2914109IPR009057Homeodomain-like
SMARTSM007171.6E-151464IPR001005SANT/Myb domain
PfamPF002494.0E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-241669IPR009057Homeodomain-like
CDDcd001676.25E-121762No hitNo description
PROSITE profilePS5129425.91863117IPR017930Myb domain
SMARTSM007171.7E-1567115IPR001005SANT/Myb domain
PfamPF002491.5E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2570118IPR009057Homeodomain-like
CDDcd001674.04E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010090Biological Processtrichome morphogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MAPKNDASTK KLMSKGPWTG EEDRKLAEYI EIHGAKRWKT VASIAGLNRC GKSCRLRWLN  60
YLRPNIKRGN ISDDEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKINQK  120
EKTSLASTAQ ETMTTITAIA PSQKASDNSA DTTTTPSQKA SDDSADTNFD VNEFFDFSAE  180
GSYGLEWVNK FLELDEDTMA AQEKVIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-301311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1592311e-114KT159231.1 Prunus persica R2R3-MYB transcription factor (MYB7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356551.11e-153PREDICTED: transcription repressor MYB5-like
TrEMBLA0A0S2MYN91e-112A0A0S2MYN9_PRUPE; R2R3-MYB transcription factor
STRINGVIT_00s0341g00050.t014e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-55myb domain protein 5